Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Bromodomain-containing protein 4 (BRD4), partial

This Recombinant Human Bromodomain-containing protein 4 (BRD4), partial spans the amino acid sequence from region 49-170aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein HUNK1

UniProt

O60885

Expression Region

49-170aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELPTEETE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glycine-L-Histidine-L-Lysine extrapure, 98%
47055 100 mg

Glycine-L-Histidine-L-Lysine extrapure, 98%

Sign In for Pricing
View Details
SLAMF7 (NM_021181) Human Tagged Lenti ORF Clone
RC220985L4 10 µg

SLAMF7 (NM_021181) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
RPL22P19 3'UTR Lenti-reporter-Luc Vector
41119081 1.0 µg

RPL22P19 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
CK15 Antibody / Cytokeratin 15
V7919-20UG 20 µg

CK15 Antibody / Cytokeratin 15

Sign In for Pricing
View Details
LOC259245 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
27055116 3x 1.0 µg

LOC259245 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Exosc1-set siRNA/shRNA/RNAi Lentivector (Mouse)
19572094 4x 500 ng

Exosc1-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details