Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Bromodomain-containing protein 2 (BRD2), partial

This Recombinant Human Bromodomain-containing protein 2 (BRD2), partial spans the amino acid sequence from region 339-459aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Really interesting new gene 3 protein

UniProt

P25440

Expression Region

339-459aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QSSKKGKLSEQLKHCNGILKELLSKKHAAYAWPFYKPVDASALGLHDYHDIIKHPMDLSTVKRKMENRDYRDAQEFAADVRLMFSNCYKYNPPDHDVVAMARKLQDVFEFRYAKMPDEPLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-O-Ethylthymidine
sc-220758 100 mg

2-O-Ethylthymidine

Sign In for Pricing
View Details
IGKV1OR15-118 Recombinant Protein (Human)
RP065010 100 µg

IGKV1OR15-118 Recombinant Protein (Human)

Sign In for Pricing
View Details
PYCRL (pyrroline-5-carboxylate Reductase-like, FLJ13852)
250750 50 µg

PYCRL (pyrroline-5-carboxylate Reductase-like, FLJ13852)

Sign In for Pricing
View Details
Recombinant Drosophila melanogaster Bursicon (burs)
AP73151 1 Each

Recombinant Drosophila melanogaster Bursicon (burs)

Sign In for Pricing
View Details
ACTR3 Mouse mAb Antibody
orb3064830-01 50 µL

ACTR3 Mouse mAb Antibody

Sign In for Pricing
View Details
ACTR3 Mouse mAb Antibody
orb3064830-02 100 µL

ACTR3 Mouse mAb Antibody

Sign In for Pricing
View Details