Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis Inhibin subunit beta E (INHBE), partial

This Recombinant Macaca fascicularis Inhibin subunit beta E (INHBE), partial spans the amino acid sequence from region 238-351aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

G7PIV1

Expression Region

238-351aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TPTCEPATPLCCRRDHYVDFQELGWQDWILQPEGYQLNYCSGQCPPHLAGSPGIAASFHSAVFSLLKANNPWPASTSCCVPTARRPLSLLYLDHNGNVVKTDVPDMVVEACGCS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SLC35C2 Pre-designed siRNA Set B
SI015060B 1 Each

Human SLC35C2 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Tantalum, powder -325 mesh
IN3397 1 Each

Tantalum, powder -325 mesh

Sign In for Pricing
View Details
GH9B16 Antibody
orb789890 2 mg

GH9B16 Antibody

Sign In for Pricing
View Details
Rabbit Anti Human ACHE Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (IHC)
IRBAMLACHEAP06120UL 1 Each

Rabbit Anti Human ACHE Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (IHC)

Sign In for Pricing
View Details
Irf3 Mouse Gene Knockout Kit (CRISPR)
KN508425 1 Kit

Irf3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Polymerase DNA Directed Delta 1 (POLd)
MBS2067764-01 0.1 mL

HRP-Linked Polyclonal Antibody to Polymerase DNA Directed Delta 1 (POLd)

Sign In for Pricing
View Details