Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ambrosia artemisiifolia Pectate lyase 5

This Recombinant Ambrosia artemisiifolia Pectate lyase 5 spans the amino acid sequence from region 26-396aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Antigen Amb a I; Antigen E; AgE; Pollen allergen Amb a 1.1; allergen Amb a 1.1

UniProt

P27759

Expression Region

26-396aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Ambrosia artemisiifolia (Short ragweed)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

46.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AEDLQEILPVNETRRLTTSGAYNIIDGCWRGKADWAENRKALADCAQGFGKGTVGGKDGDIYTVTSELDDDVANPKEGTLRFGAAQNRPLWIIFERDMVIRLDKEMVVNSDKTIDGRGAKVEIINAGFTLNGVKNVIIHNINMHDVKVNPGGLIKSNDGPAAPRAGSDGDAISISGSSQIWIDHCSLSKSVDGLVDAKLGTTRLTVSNSLFTQHQFVLLFGAGDENIEDRGMLATVAFNTFTDNVDQRMPRCRHGFFQVVNNNYDKWGSYAIGGSASPTILSQGNRFCAPDERSKKNVLGRHGEAAAESMKWNWRTNKDVLENGAIFVASGVDPVLTPEQSAGMIPAEPGESALSLTSSAGVLSCQPGAPC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ITIH4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K1106305 3x 1.0 µg

ITIH4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
OSBPL5 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV635330 1.0 µg DNA

OSBPL5 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
C15orf61 Human shRNA Plasmid Kit (Locus ID 145853)
TR321317 1 Kit

C15orf61 Human shRNA Plasmid Kit (Locus ID 145853)

Sign In for Pricing
View Details
Recombinant Angiomotin Like Protein 2 (AMOTL2)
SIPF940Hu01-01 10 µg

Recombinant Angiomotin Like Protein 2 (AMOTL2)

Sign In for Pricing
View Details
Recombinant Angiomotin Like Protein 2 (AMOTL2)
SIPF940Hu01-02 50 µg

Recombinant Angiomotin Like Protein 2 (AMOTL2)

Sign In for Pricing
View Details
Recombinant Angiomotin Like Protein 2 (AMOTL2)
SIPF940Hu01-03 200 µg

Recombinant Angiomotin Like Protein 2 (AMOTL2)

Sign In for Pricing
View Details