Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein C8orf76 (C8orf76)

This Recombinant Human Uncharacterized protein C8orf76 (C8orf76) spans the amino acid sequence from region 1-380aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

Q96K31

Expression Region

1-380aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

50.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDSGCWLFGGEFEDSVFEERPERRSGPPASYCAKLCEPQWFYEETESSDDVEVLTLKKFKGDLAYRRQEYQKALQEYSSISEKLSSTNFAMKRDVQEGQARCLAHLGRHMEALEIAANLENKATNTDHLTTVLYLQLAICSSLQNLEKTIFCLQKLISLHPFNPWNWGKLAEAYLNLGPALSAALASSQKQHSFTSSDKTIKSFFPHSGKDCLLCFPETLPESSLFSVEANSSNSQKNEKALTNIQNCMAEKRETVLIETQLKACASFIRTRLLLQFTQPQQTSFALERNLRTQQEIEDKMKGFSFKEDTLLLIAEVMGEDIPEKIKDEVHPEVKCVGSVALTALVTVSSEEFEDKWFRKIKDHFCPFENQFHTEIQILA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human FXN (Frataxi) ELISA Kit
orb1715076-01 48 Tests

Human FXN (Frataxi) ELISA Kit

Sign In for Pricing
View Details
Human FXN (Frataxi) ELISA Kit
orb1715076-02 96 Tests

Human FXN (Frataxi) ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal Siglec-16 Antibody (706030) [Janelia Fluor 669]
FAB68192JF669 0.1 mL

Mouse Monoclonal Siglec-16 Antibody (706030) [Janelia Fluor 669]

Sign In for Pricing
View Details
PSin-EF2-IL21-Puro Plasmid
PVT72852 2 µg

PSin-EF2-IL21-Puro Plasmid

Sign In for Pricing
View Details
4- (Diethylamino) But-2-Yn-1-Yl 2-Cyclohexyl-2-Hydroxy-2-Phenylacetate
OR1029392 1 Each

4- (Diethylamino) But-2-Yn-1-Yl 2-Cyclohexyl-2-Hydroxy-2-Phenylacetate

Sign In for Pricing
View Details
Tmem184a sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4364503 1.0 µg DNA

Tmem184a sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details