Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Inhibin beta E chain (Inhbe)

This Recombinant Rat Inhibin beta E chain (Inhbe) spans the amino acid sequence from region 237-350aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Activin beta-E chain

UniProt

O88959

Expression Region

237-350aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Signal Transduction

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TPTCESETPLCCRRDHYVDFQELGWRDWILQPEGYQLNYCSGQCPPHLAGSPGIAASFHSAVFSLLKANNPWPAGSSCCVPTARRPLSLLYLDHNGNVVKTDVPDMVVEACGCS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VPS41 (NM_014396) Human Recombinant Protein
TP307267 20 µg

VPS41 (NM_014396) Human Recombinant Protein

Sign In for Pricing
View Details
3,4-Diaminobenzophenone
TRC-D416100-1G 1 g

3,4-Diaminobenzophenone

Sign In for Pricing
View Details
Annexin A1 / (Hairy Cell Leukemia Marker) (6E4/3), CF740 conjugate, 0.1mg/mL
BNC742179-100 1x 100 µL

Annexin A1 / (Hairy Cell Leukemia Marker) (6E4/3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary: left
CS635575 5x 5 µm

Frozen Tissue Sections, Ovary: left

Sign In for Pricing
View Details
Poly(vinyl Cinnamate) ( average Mn 40,000, powder)
TRC-P699170-500MG 500 mg

Poly(vinyl Cinnamate) ( average Mn 40,000, powder)

Sign In for Pricing
View Details
Scube1 Mouse Gene Knockout Kit (CRISPR)
KN515410 1 Kit

Scube1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details