Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Inhibin beta E chain (Inhbe)

This Recombinant Rat Inhibin beta E chain (Inhbe) spans the amino acid sequence from region 237-350aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Activin beta-E chain

UniProt

O88959

Expression Region

237-350aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Signal Transduction

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TPTCESETPLCCRRDHYVDFQELGWRDWILQPEGYQLNYCSGQCPPHLAGSPGIAASFHSAVFSLLKANNPWPAGSSCCVPTARRPLSLLYLDHNGNVVKTDVPDMVVEACGCS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Leibovitzs L-15 Without Phenol Red 500ml
ILEIBOVITZSL151013500ML 500 mL

Leibovitzs L-15 Without Phenol Red 500ml

Sign In for Pricing
View Details
Rabbit anti-Synechococcus elongatus (strain PCC 7942)(Anacystis nidulans R2) PSAC Polyclonal Antibody
MBS7193449 Inquire

Rabbit anti-Synechococcus elongatus (strain PCC 7942)(Anacystis nidulans R2) PSAC Polyclonal Antibody

Sign In for Pricing
View Details
TAF8 Protein Vector (Human) (pPM-C-HA)
46092021 500 ng

TAF8 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Monoclonal MLC1SA Antibody (monoclonal) (M01), Clone: 4G11
APR17389G 0.1mg

Monoclonal MLC1SA Antibody (monoclonal) (M01), Clone: 4G11

Sign In for Pricing
View Details
pCR4-TOPO-RNASE2 Plasmid
PVT33885 2 µg

pCR4-TOPO-RNASE2 Plasmid

Sign In for Pricing
View Details
IFNG Antibody (PE)
orb1271236 25 Tests

IFNG Antibody (PE)

Sign In for Pricing
View Details