Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Macrophage colony-stimulating factor 1 (CSF1), partial

This Recombinant Human Macrophage colony-stimulating factor 1 (CSF1), partial spans the amino acid sequence from region 33-190aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CSF-1; M-CSF; MCSF; Lanimostim

UniProt

P09603

Expression Region

33-190aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQDVVTKPDCN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MS4A14 Rabbit pAb, AP conjugated
orb2888804 100 µL

MS4A14 Rabbit pAb, AP conjugated

Sign In for Pricing
View Details
Rabbit Human PINK1 (N-Terminal) Antibody
orb109580 100 µg

Rabbit Human PINK1 (N-Terminal) Antibody

Sign In for Pricing
View Details
UBE3A Peptide - N-terminal region
orb2016584 100 µg

UBE3A Peptide - N-terminal region

Sign In for Pricing
View Details
Monoerucin
TRC-M548700-50MG 50 mg

Monoerucin

Sign In for Pricing
View Details
PELI1 Polyclonal Antibody
MBS8573843-01 0.1 mL

PELI1 Polyclonal Antibody

Sign In for Pricing
View Details
PELI1 Polyclonal Antibody
MBS8573843-02 0.1 mL (AF405L)

PELI1 Polyclonal Antibody

Sign In for Pricing
View Details