Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Histone deacetylase 2 (Hdac2)

This Recombinant Mouse Histone deacetylase 2 (Hdac2) spans the amino acid sequence from region 1-488aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

HD2; Protein deacylase HDAC2; YY1 transcription factor-binding protein

UniProt

P70288

Expression Region

1-488aa

Tag

Tag-Free

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

55.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVAKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDPKGAKSEQLSNP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EFS (NM_032459) Human Recombinant Protein
TP303800 20 µg

EFS (NM_032459) Human Recombinant Protein

Sign In for Pricing
View Details
STING (TMEM173) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4E12]
TA505032AM 100 µL

STING (TMEM173) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4E12]

Sign In for Pricing
View Details
(+)-Valienamine Hydrochloride
TRC-V094000-2.5MG 2.5 mg

(+)-Valienamine Hydrochloride

Sign In for Pricing
View Details
Phospholipase C gamma 1 (PLCG1) (970-990) (incl. pos. control) Mouse Monoclonal Antibody [Clone ID: 2D5]
AM20220PU-N 100 µg

Phospholipase C gamma 1 (PLCG1) (970-990) (incl. pos. control) Mouse Monoclonal Antibody [Clone ID: 2D5]

Sign In for Pricing
View Details
IL6 Antibody
KC-011-01 50 μL

IL6 Antibody

Sign In for Pricing
View Details
IL6 Antibody
KC-011-02 100 µL

IL6 Antibody

Sign In for Pricing
View Details