Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Formin-2 (FMN2), partial

This Recombinant Human Formin-2 (FMN2), partial spans the amino acid sequence from region 1284-1673aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

Q9NZ56

Expression Region

1284-1673aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

51.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KQPIEPCRPMKPLYWTRIQLHSKRDSSTSLIWEKIEEPSIDCHEFEELFSKTAVKERKKPISDTISKTKAKQVVKLLSNKRSQAVGILMSSLHLDMKDIQHAVVNLDNSVVDLETLQALYENRAQSDELEKIEKHGRSSKDKENAKSLDKPEQFLYELSLIPNFSERVFCILFQSTFSESICSIRRKLELLQKLCETLKNGPGVMQVLGLVLAFGNYMNGGNKTRGQADGFGLDILPKLKDVKSSDNSRSLLSYIVSYYLRNFDEDAGKEQCLFPLPEPQDLFQASQMKFEDFQKDLRKLKKDLKACEVEAGKVYQVSSKEHMQPFKENMEQFIIQAKIDQEAEENSLTETHKCFLETTAYFFMKPKLGEKEVSPNAFFSIWHEFSSDFK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LNX1 rabbit pAb
E28PN4914 100 µL

LNX1 rabbit pAb

Sign In for Pricing
View Details
B2M Peptide
43-049P 0.1 mg

B2M Peptide

Sign In for Pricing
View Details
Anti-SETD7/Set7 Rabbit Monoclonal Antibody
M02793 100 µL/Vial

Anti-SETD7/Set7 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
TRIB3 Polyclonal Antibody, RBITC Conjugated
bs-7538R-RBITC-TR 20 µL

TRIB3 Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details
GLI3 Rabbit Monoclonal Antibody
E10G21446 100 µL

GLI3 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal GST Epitope Tag Antibody [mFluor Violet 450 SE]
NBP2-37820MFV450 0.1 mL

Rabbit Polyclonal GST Epitope Tag Antibody [mFluor Violet 450 SE]

Sign In for Pricing
View Details