Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interleukin-13 (Il13)

This Recombinant Mouse Interleukin-13 (Il13) spans the amino acid sequence from region 19-131aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IL-13; T-cell activation protein P600

UniProt

P20109

Expression Region

19-131aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APGPVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Motilin (mLN) (NM_002418) Human Tagged ORF Clone Lentiviral Particle
RC222245L3V 200 µL

Motilin (mLN) (NM_002418) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
AF251705 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3322605 3x 1.0 µg

AF251705 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
ETV3 Human Gene Knockout Kit (CRISPR)
KN404995 1 Kit

ETV3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Goat Anti-Skin Antibody, ASA ELISA Kit
MBS7222726-01 48 Well

Goat Anti-Skin Antibody, ASA ELISA Kit

Sign In for Pricing
View Details
Goat Anti-Skin Antibody, ASA ELISA Kit
MBS7222726-02 96 Well

Goat Anti-Skin Antibody, ASA ELISA Kit

Sign In for Pricing
View Details
Goat Anti-Skin Antibody, ASA ELISA Kit
MBS7222726-03 5x 96 Well

Goat Anti-Skin Antibody, ASA ELISA Kit

Sign In for Pricing
View Details