Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis Lymphotoxin beta receptor (LTBR), partial

This Recombinant Macaca fascicularis Lymphotoxin beta receptor (LTBR), partial spans the amino acid sequence from region 28-229aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

A0A2K5VGQ6

Expression Region

28-229aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SQPQVVRKGPVPPYGSENQTCRDQEKEYYEPRHRICCSRCPPGTYVSAKCSRSRDTVCATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKRKTQCRCQPGMFCAAWALECTHCELLSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCEDQGLVEAAPGTAQSDTTCRNPSESLPPEMSGT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,7-Dimethyl-1H-indole-3-carbaldehyde ≥95% (NMR)
231031-01 250 mg

2,7-Dimethyl-1H-indole-3-carbaldehyde ≥95% (NMR)

Sign In for Pricing
View Details
2,7-Dimethyl-1H-indole-3-carbaldehyde ≥95% (NMR)
231031-02 1 g

2,7-Dimethyl-1H-indole-3-carbaldehyde ≥95% (NMR)

Sign In for Pricing
View Details
2,7-Dimethyl-1H-indole-3-carbaldehyde ≥95% (NMR)
231031-03 5 g

2,7-Dimethyl-1H-indole-3-carbaldehyde ≥95% (NMR)

Sign In for Pricing
View Details
2,7-Dimethyl-1H-indole-3-carbaldehyde ≥95% (NMR)
231031-04 25 g

2,7-Dimethyl-1H-indole-3-carbaldehyde ≥95% (NMR)

Sign In for Pricing
View Details
LentimiRa-Off-hsa-miR-2114-3p Vector
mh30333 500 ng

LentimiRa-Off-hsa-miR-2114-3p Vector

Sign In for Pricing
View Details
AxyPrep Mag Plant DNA-384 Prep
AXY1058 1 Each

AxyPrep Mag Plant DNA-384 Prep

Sign In for Pricing
View Details