Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Tumor necrosis factor receptor superfamily member 3 (Ltbr), partial

This Recombinant Mouse Tumor necrosis factor receptor superfamily member 3 (Ltbr), partial spans the amino acid sequence from region 31-223aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Lymphotoxin-beta receptor

UniProt

P50284

Expression Region

31-223aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cancer Biology; Immunology & Inflammation; Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QLVPPYRIENQTCWDQDKEYYEPMHDVCCSRCPPGEFVFAVCSRSQDTVCKTCPHNSYNEHWNHLSTCQLCRPCDIVLGFEEVAPCTSDRKAECRCQPGMSCVYLDNECVHCEEERLVLCQPGTEAEVTDEIMDTDVNCVPCKPGHFQNTSSPRARCQPHTRCEIQGLVEAAPGTSYSDTICKNPPEPGAMLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5,7-Dibromo-2,3-dihydrothieno[3,4-b][1,4]dioxine
OR9626-01 250 mg

5,7-Dibromo-2,3-dihydrothieno[3,4-b][1,4]dioxine

Sign In for Pricing
View Details
5,7-Dibromo-2,3-dihydrothieno[3,4-b][1,4]dioxine
OR9626-02 1 g

5,7-Dibromo-2,3-dihydrothieno[3,4-b][1,4]dioxine

Sign In for Pricing
View Details
GlnA Antibody
orb815757 2 mg

GlnA Antibody

Sign In for Pricing
View Details
ABAT Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb2420030 100 µL

ABAT Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details
KIF22 (NM_001256269) Human Tagged ORF Clone
RC234520 10 µg

KIF22 (NM_001256269) Human Tagged ORF Clone

Sign In for Pricing
View Details
Rabbit Anti-Endothelial Cell Antibody ELISA Kit
MBS732766-01 48 Well

Rabbit Anti-Endothelial Cell Antibody ELISA Kit

Sign In for Pricing
View Details