Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Marmota monax Tumor necrosis factor (TNF), partial

This Recombinant Marmota monax Tumor necrosis factor (TNF), partial spans the amino acid sequence from region 57-233aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cachectin

UniProt

O35734

Expression Region

57-233aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Marmota monax (Woodchuck)

Field of Research

Cancer Biology; Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GPQREEFLNNLPLSPQAQMLTLRSSSQNMNDKPVAHVVAKNEDKEQLVWLSRRANALLANGMELIDNQLVVPANGLYLVYSQVLFKGQGCPSYVLLTHTVSRFAVSYQDKVNLLSAIKSPCPKESLEGAEFKPWYEPIYLGGVFELQKGDRLSAEVNLPSYLDFAESGQVYFGVIAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MORC3 Mouse Monoclonal Antibody [Clone ID: 17A9]
AM26535AF-N 100 µg

MORC3 Mouse Monoclonal Antibody [Clone ID: 17A9]

Sign In for Pricing
View Details
trans-Zeatin
TRC-Z273000-50MG 50 mg

trans-Zeatin

Sign In for Pricing
View Details
IL17REL (NM_001001694) Human Over-expression Lysate
LY424210 100 µg

IL17REL (NM_001001694) Human Over-expression Lysate

Sign In for Pricing
View Details
Automated Sample Processing System BLIH-601
BLIH-601 1 Unit

Automated Sample Processing System BLIH-601

Sign In for Pricing
View Details
MUC4 Human Gene Knockout Kit (CRISPR)
KN212206LP 1 Kit

MUC4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PTEN Recombinant Rabbit Monoclonal Antibody [JE51-96]
HA721962 100 µL

PTEN Recombinant Rabbit Monoclonal Antibody [JE51-96]

Sign In for Pricing
View Details