Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Alpha-hemoglobin-stabilizing protein (Ahsp)

This Recombinant Mouse Alpha-hemoglobin-stabilizing protein (Ahsp) spans the amino acid sequence from region 1-102aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Erythroid differentiation-related factor; Erythroid-associated factor

UniProt

Q9CY02

Expression Region

1-102aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Cardiovascular Research

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAPFQSNKDLISTGIKEFNVLLDQQVFDDPLISEEDMVIVVHDWVNLYTNYYKKLVHGEQEEQDRAMTEFQQELSTLGSQFLAKYRTFLKSKEPPSNTLPSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DdATP [2',3'-Dideoxyadenosine-5'-triphosphate] *10 mM in ddH2O*
17209-AAT 1 µmole

DdATP [2',3'-Dideoxyadenosine-5'-triphosphate] *10 mM in ddH2O*

Sign In for Pricing
View Details
TRAF6 (NM_004620) Human Over-expression Lysate
LY401463 100 µg

TRAF6 (NM_004620) Human Over-expression Lysate

Sign In for Pricing
View Details
Uncoated Porcine IL-1β (Interleukin 1 Beta) ELISA Kit
E-UNEL-P0007-01 5x 96 Tests

Uncoated Porcine IL-1β (Interleukin 1 Beta) ELISA Kit

Sign In for Pricing
View Details
Uncoated Porcine IL-1β (Interleukin 1 Beta) ELISA Kit
E-UNEL-P0007-02 15x 96 Tests

Uncoated Porcine IL-1β (Interleukin 1 Beta) ELISA Kit

Sign In for Pricing
View Details
Granzyme B (NK/T-Cell Lymphoma Marker) (GZMB/3056), CF640R conjugate, 0.1mg/mL
BNC403056-500 1x 500 µL

Granzyme B (NK/T-Cell Lymphoma Marker) (GZMB/3056), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MMP-3 Recombinant Rabbit Monoclonal Antibody [JM46-22]
ET1705-98 100 µL

MMP-3 Recombinant Rabbit Monoclonal Antibody [JM46-22]

Sign In for Pricing
View Details