Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Alpha-hemoglobin-stabilizing protein (Ahsp)

This Recombinant Mouse Alpha-hemoglobin-stabilizing protein (Ahsp) spans the amino acid sequence from region 1-102aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Erythroid differentiation-related factor; Erythroid-associated factor

UniProt

Q9CY02

Expression Region

1-102aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Cardiovascular Research

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAPFQSNKDLISTGIKEFNVLLDQQVFDDPLISEEDMVIVVHDWVNLYTNYYKKLVHGEQEEQDRAMTEFQQELSTLGSQFLAKYRTFLKSKEPPSNTLPSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin, HMW (AE-3), CF488A conjugate, 0.1mg/mL
BNC880257-500 1x 500 µL

Cytokeratin, HMW (AE-3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SEPT2 Antibody
8C18509-AAT 50 µg

SEPT2 Antibody

Sign In for Pricing
View Details
UROS Human Gene Knockout Kit (CRISPR)
KN400385 1 Kit

UROS Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Zfp354a activation kit by CRISPRa
GA204235 1 Kit

Mouse Zfp354a activation kit by CRISPRa

Sign In for Pricing
View Details
LMO2 (B-Cell Marker) (LMO2/3147R), CF647 conjugate, 0.1mg/mL
BNC473147-500 1x 500 µL

LMO2 (B-Cell Marker) (LMO2/3147R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SN-38 Glucuronide
TRC-S589980-1MG 1 mg

SN-38 Glucuronide

Sign In for Pricing
View Details