Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rabbit B (0, +) -type amino acid transporter 1 (SLC7A9), partial

This Recombinant Rabbit B (0, +) -type amino acid transporter 1 (SLC7A9), partial spans the amino acid sequence from region 451-487aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

4F2-LC6; Glycoprotein-associated amino acid transporter b0, +AT1; Solute carrier family 7 member 9

UniProt

Q9N1R6

Expression Region

451-487aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Oryctolagus cuniculus (Rabbit)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

6.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YFLFVYYKFEWAQKISKPITMHLQMLMEVVPPEPDPK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Villin1 Recombinant Rabbit monoclonal Antibody
HA750477 100 µL

Villin1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Human LIX1 activation kit by CRISPRa
GA116157 1 Kit

Human LIX1 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Rat ACE protein (His tag)
PDER100209-01 20 µg

Recombinant Rat ACE protein (His tag)

Sign In for Pricing
View Details
Recombinant Rat ACE protein (His tag)
PDER100209-02 100 µg

Recombinant Rat ACE protein (His tag)

Sign In for Pricing
View Details
Recombinant Rat ACE protein (His tag)
PDER100209-03 500 µg

Recombinant Rat ACE protein (His tag)

Sign In for Pricing
View Details
Recombinant Rat ACE protein (His tag)
PDER100209-04 1 mg

Recombinant Rat ACE protein (His tag)

Sign In for Pricing
View Details