Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rabbit B (0, +) -type amino acid transporter 1 (SLC7A9), partial

This Recombinant Rabbit B (0, +) -type amino acid transporter 1 (SLC7A9), partial spans the amino acid sequence from region 451-487aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

4F2-LC6; Glycoprotein-associated amino acid transporter b0, +AT1; Solute carrier family 7 member 9

UniProt

Q9N1R6

Expression Region

451-487aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Oryctolagus cuniculus (Rabbit)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

6.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YFLFVYYKFEWAQKISKPITMHLQMLMEVVPPEPDPK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PIK3R5 Rabbit Polyclonal Antibody (FITC)
orb2584473 100 µg

PIK3R5 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Tas2r130 (NM_199156) Mouse Tagged ORF Clone
MR220167 10 µg

Tas2r130 (NM_199156) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Cation-dependent mannose-6-phosphate Receptor (M6PR) Bovine ELISA Kit
C1927 96 Tests

Cation-dependent mannose-6-phosphate Receptor (M6PR) Bovine ELISA Kit

Sign In for Pricing
View Details
PSD95 (DLG4) Rabbit Polyclonal Antibody
TA375493 100 µL

PSD95 (DLG4) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
2-Methyl-5- (1-methyl-1H-imidazole-5-carbonyl) pyridine
NLA39221-01 50 mg

2-Methyl-5- (1-methyl-1H-imidazole-5-carbonyl) pyridine

Sign In for Pricing
View Details
2-Methyl-5- (1-methyl-1H-imidazole-5-carbonyl) pyridine
NLA39221-02 0.5 g

2-Methyl-5- (1-methyl-1H-imidazole-5-carbonyl) pyridine

Sign In for Pricing
View Details