Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Mannose-binding protein C (MBL2)

This Recombinant Human Mannose-binding protein C (MBL2) spans the amino acid sequence from region 21-248aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MBP-C; Collectin-1; MBP1; Mannan-binding protein; Mannose-binding lectin

UniProt

P11226

Expression Region

21-248aa

Tag

N-terminal 6xHis-sumostar-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

37.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKGEPGQGLRGLQGPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMARIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSHLAVCEFPI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MCAM (Melanoma Cell Adhesion Molecule) / MUC18 / CD146 (MCAM/3046), CF647 conjugate, 0.1mg/mL
BNC473046-100 1x 100 µL

MCAM (Melanoma Cell Adhesion Molecule) / MUC18 / CD146 (MCAM/3046), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tau (S293) Antibody
KC-43235-01 50 μL

Tau (S293) Antibody

Sign In for Pricing
View Details
Tau (S293) Antibody
KC-43235-02 100 µL

Tau (S293) Antibody

Sign In for Pricing
View Details
Tau (S293) Antibody
KC-43235-03 1 mL

Tau (S293) Antibody

Sign In for Pricing
View Details
Human PAI1 Recombinant Rabbit monoclonal Antibody
HA723439B 100 µL

Human PAI1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Melanoma Marker (PNL2), CF594 conjugate, 0.1mg/mL
BNC940894-500 1x 500 µL

Melanoma Marker (PNL2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details