Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase (gpmA)

This Recombinant Escherichia coli 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase (gpmA) spans the amino acid sequence from region 2-250aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

BPG-dependent PGAM; PGAM; Phosphoglyceromutase; dPGM

UniProt

P62707

Expression Region

2-250aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AVTKLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVLKRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNETILPRMKSGERVIIAAHGNSLRALVKYLDNMSEEEILELNIPTGVPLVYEFDENFKPLKRYYLGNADEIAAKAAAVANQGKAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

YAP1 Antibody
MBS5311493-01 0.1 mg

YAP1 Antibody

Sign In for Pricing
View Details
YAP1 Antibody
MBS5311493-02 5x 0.1 mg

YAP1 Antibody

Sign In for Pricing
View Details
EPHB2, His-tag
40200 10 µg

EPHB2, His-tag

Sign In for Pricing
View Details
Pofut2 (NM_030262) Mouse Recombinant Protein
E45M43886M5 20 µg

Pofut2 (NM_030262) Mouse Recombinant Protein

Sign In for Pricing
View Details
Azido-PEG11-acid
HY-133317 1 Each

Azido-PEG11-acid

Sign In for Pricing
View Details
NR3C2/Mineralocorticoid receptor Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb1591923 100 µL

NR3C2/Mineralocorticoid receptor Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details