Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human GTPase KRas (KRAS)

This Recombinant Human GTPase KRas (KRAS) spans the amino acid sequence from region 2-186aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

K-Ras 2; Ki-Ras; c-K-ras; c-Ki-ras

UniProt

P01116

Expression Region

2-186aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGCVKIKKC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vom2r64 (NM_001099513) Rat Tagged ORF Clone
RR201922 10 µg

Vom2r64 (NM_001099513) Rat Tagged ORF Clone

Sign In for Pricing
View Details
FABP4 Rabbit Polyclonal Antibody (BF594)
orb2424901 100 µL

FABP4 Rabbit Polyclonal Antibody (BF594)

Sign In for Pricing
View Details
ZNF799 antibody
70R-8173 100 µL

ZNF799 antibody

Sign In for Pricing
View Details
Adam15 Rat shRNA Plasmid (Locus ID 57025)
TR710419 1 Kit

Adam15 Rat shRNA Plasmid (Locus ID 57025)

Sign In for Pricing
View Details
Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Endonuclease III (nth)
MBS1117296-01 0.05 mg (E-Coli)

Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Endonuclease III (nth)

Sign In for Pricing
View Details
Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Endonuclease III (nth)
MBS1117296-02 0.05 mg (Yeast)

Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Endonuclease III (nth)

Sign In for Pricing
View Details