Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis Jacalin-type lectin domain-containing protein, partial

This Recombinant Macaca fascicularis Jacalin-type lectin domain-containing protein, partial spans the amino acid sequence from region 23-169aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

G7Q0A1

Expression Region

23-169aa

Tag

C-terminal 10xHis-tagged

Source

Yeast

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Field of Research

Cancer Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GKMYGPGGGKYFTTTEDYDHEITGLRVSVGLLLVKSVQVKLGDTWDVKQGASGGNTQEVTLQPGEYITKVFVAFQTFLRGMVLYTSKDRTFYFGKLDGQIFSVYPSQEGQVLVGIYGQYGLLGIKSIGFEWNYPLEEPTTEPPVTVT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Flotillin 2 Antibody
RC-14983-01 50 μL

Recombinant Flotillin 2 Antibody

Sign In for Pricing
View Details
Recombinant Flotillin 2 Antibody
RC-14983-02 100 µL

Recombinant Flotillin 2 Antibody

Sign In for Pricing
View Details
Recombinant Flotillin 2 Antibody
RC-14983-03 1 mL

Recombinant Flotillin 2 Antibody

Sign In for Pricing
View Details
Aldolase (ALDOA) (NM_001127617) Human Over-expression Lysate
LC426825 20 µg

Aldolase (ALDOA) (NM_001127617) Human Over-expression Lysate

Sign In for Pricing
View Details
2-(o-Chlorophenyl)-1-ethoxylethylene (cis trans mixture)
TRC-C379525-5G 5 g

2-(o-Chlorophenyl)-1-ethoxylethylene (cis trans mixture)

Sign In for Pricing
View Details
Barbituric Acid-13C,15N2
TRC-B118652-1MG 1 mg

Barbituric Acid-13C,15N2

Sign In for Pricing
View Details