Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis Jacalin-type lectin domain-containing protein, partial

This Recombinant Macaca fascicularis Jacalin-type lectin domain-containing protein, partial spans the amino acid sequence from region 23-169aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

G7Q0A1

Expression Region

23-169aa

Tag

C-terminal 10xHis-tagged

Source

Yeast

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Field of Research

Cancer Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GKMYGPGGGKYFTTTEDYDHEITGLRVSVGLLLVKSVQVKLGDTWDVKQGASGGNTQEVTLQPGEYITKVFVAFQTFLRGMVLYTSKDRTFYFGKLDGQIFSVYPSQEGQVLVGIYGQYGLLGIKSIGFEWNYPLEEPTTEPPVTVT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

I-Sydnocarb
TRC-S920005-50MG 50 mg

I-Sydnocarb

Sign In for Pricing
View Details
CCR8 Human Gene Knockout Kit (CRISPR)
KN415427 1 Kit

CCR8 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HSP90AA1 Human Gene Knockout Kit (CRISPR)
KN212496BN 1 Kit

HSP90AA1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CTNND1 (NM_001085458) Human Over-expression Lysate
LC421307 20 µg

CTNND1 (NM_001085458) Human Over-expression Lysate

Sign In for Pricing
View Details
BIN1 Mouse Monoclonal Antibody [Clone ID: BN-1]
AM20586PU-N 100 µg

BIN1 Mouse Monoclonal Antibody [Clone ID: BN-1]

Sign In for Pricing
View Details
Ferritin Light Chain (FTL) (NM_000146) Human Over-expression Lysate
LC400051 20 µg

Ferritin Light Chain (FTL) (NM_000146) Human Over-expression Lysate

Sign In for Pricing
View Details