Recombinant Chicken Platelet derived growth factor subunit B (PDGF-B), partial
This Recombinant Chicken Platelet derived growth factor subunit B (PDGF-B), partial spans the amino acid sequence from region 68-197aa. Purity: Greater than 95% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
PDGF-2; Platelet-derived growth factor B chain ; Platelet-derived growth factor beta polypeptide
UniProt
Q90W23
Expression Region
68-197aa
Tag
N-terminal 6xHis-tagged
Source
Yeast
Origin
Gallus gallus (Chicken)
Field of Research
Stem Cell & Developmental Biology
Purity
Greater than 95% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
16.9 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
SLDLNATQPSQNHVSLSRERRSLDALAAAEPAVLAECKTRTVVFEISRDMVDSTNANFVVWPPCVEVQRCSGCCNNRNVQCRPMQIRVRHVQVNKIEFFQRKPIFKKVIVPLEDHVQCRCEVVSRPPPRS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![PE/Cyanine5.5 Anti-Mouse CD14 Antibody[Sa14-2]](https://cdn.genprice.uk/products/763/68dd1498061270361e7ce534/imageurl/e-ab-f1176ui.webp)
E-AB-F1176UI-01 25 µg
PE/Cyanine5.5 Anti-Mouse CD14 Antibody[Sa14-2]
Sign In for Pricing
View Details E-AB-F1176UI-02 100 µg
PE/Cyanine5.5 Anti-Mouse CD14 Antibody[Sa14-2]
Sign In for Pricing
View Details 
![RIP (RIPK1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2F1]](https://cdn.genprice.uk/products/937/6868c385994c49e6dc3f9550/imageurl/ta800307am.webp)
TA800307AM 100 µL
RIP (RIPK1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2F1]
Sign In for Pricing
View Details 