Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ras-related protein Rab-27A (RAB27A)

This Recombinant Human Ras-related protein Rab-27A (RAB27A) spans the amino acid sequence from region 2-221aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Rab-27; GTP-binding protein Ram

UniProt

P51159

Expression Region

2-221aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SDGDYDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRASGPDGATGRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACGC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp946 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
51195124 3x 1.0µg DNA

Zfp946 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
OPTN (Optineurin, NRP, FIP2, Huntingtin-interacting Protein 7, HIP7, HYPL, ALS12, GLC1E, TFIIIA-IntP) (Biotin)
MBS6430183-01 0.1 mL

OPTN (Optineurin, NRP, FIP2, Huntingtin-interacting Protein 7, HIP7, HYPL, ALS12, GLC1E, TFIIIA-IntP) (Biotin)

Sign In for Pricing
View Details
OPTN (Optineurin, NRP, FIP2, Huntingtin-interacting Protein 7, HIP7, HYPL, ALS12, GLC1E, TFIIIA-IntP) (Biotin)
MBS6430183-02 5x 0.1 mL

OPTN (Optineurin, NRP, FIP2, Huntingtin-interacting Protein 7, HIP7, HYPL, ALS12, GLC1E, TFIIIA-IntP) (Biotin)

Sign In for Pricing
View Details
ZCCHC18 sgRNA CRISPR Lentivector (Human) (Target 1)
K2667602 1.0 µg DNA

ZCCHC18 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Human TSEN34 Protein Lysate
MBS8429200-01 0.02 mg

Human TSEN34 Protein Lysate

Sign In for Pricing
View Details
Human TSEN34 Protein Lysate
MBS8429200-02 5x 0.02 mg

Human TSEN34 Protein Lysate

Sign In for Pricing
View Details