Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Pro-epidermal growth factor (EGF), partial

This Recombinant Chicken Pro-epidermal growth factor (EGF), partial spans the amino acid sequence from region 1026-1080aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

Q6PPB4

Expression Region

1026-1080aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Gallus gallus (Chicken)

Field of Research

Cancer Biology; Stem Cell & Developmental Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

8.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GDSIGCPPAYDSYCLHGGVCNYVSDLQDYACNCVTGYVGERCQFSDLEWWEQQHA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LIMK-IN-1
BA4229-2 2 mg

LIMK-IN-1

Sign In for Pricing
View Details
CAPN13 Protein Vector (Mouse) (pPB-C-His)
PV161386 500 ng

CAPN13 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
THOC5 3'UTR GFP Stable Cell Line
TU075544 1.0 mL

THOC5 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
(S) - (-) -Bay K8644
E4039-25mg 25 mg

(S) - (-) -Bay K8644

Sign In for Pricing
View Details
Zmym1 ORF Vector (Mouse) (pORF)
ORF062717 1.0 µg DNA

Zmym1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
ANKS6 Rabbit Polyclonal Antibody (BF350)
orb2379422 100 µL

ANKS6 Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details