Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Fibroblast growth factor 1 (FGF1)

This Recombinant Bovine Fibroblast growth factor 1 (FGF1) spans the amino acid sequence from region 2-155aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

FGF-1; Acidic eye-derived growth factor II; EDGF II; Acidic fibroblast growth factor; aFGF; Endothelial cell growth factor; ECGF; Heparin-binding growth factor 1; HBGF-1; Prostatropin

UniProt

P03968

Expression Region

2-155aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Bos taurus (Bovine)

Field of Research

Cardiovascular Research; Stem Cell & Developmental Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AEGETTTFTALTEKFNLPLGNYKKPKLLYCSNGGYFLRILPDGTVDGTKDRSDQHIQLQLCAESIGEVYIKSTETGQFLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKHWFVGLKKNGRSKLGPRTHFGQKAILFLPLPVSSD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Metastasis, unknown source
CS802784 5x 5 µm

Tissue FFPE Sections, Metastasis, unknown source

Sign In for Pricing
View Details
PTau231 Antibody
KC-44823-01 50 μL

PTau231 Antibody

Sign In for Pricing
View Details
PTau231 Antibody
KC-44823-02 100 µL

PTau231 Antibody

Sign In for Pricing
View Details
PTau231 Antibody
KC-44823-03 1 mL

PTau231 Antibody

Sign In for Pricing
View Details
Normesuximide
TRC-N720500-5G 5 g

Normesuximide

Sign In for Pricing
View Details
Msh6 Mouse Gene Knockout Kit (CRISPR)
KN310424 1 Kit

Msh6 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details