Recombinant Chicken Fibroblast growth factor 1 (FGF1)
This Recombinant Chicken Fibroblast growth factor 1 (FGF1) spans the amino acid sequence from region 16-155aa. Purity: Greater than 95% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
FGF-1; Acidic fibroblast growth factor; aFGF; Endothelial cell growth factor; ECGF; Heparin-binding growth factor 1; HBGF-1
UniProt
P19596
Expression Region
16-155aa
Tag
N-terminal 6xHis-tagged
Source
Yeast
Origin
Gallus gallus (Chicken)
Field of Research
Cardiovascular Research; Stem Cell & Developmental Biology
Purity
Greater than 95% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
17.7 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
FGLPLGNYKKPKLLYCSNGGHFLRILPDGKVDGTRDRSDQHIQLQLSAEDVGEVYIKSTASGQYLAMDTNGLLYGSQLPGEECLFLERLEENHYNTYISKKHADKNWFVGLKKNGNSKLGPRTHYGQKAILFLPLPVSAD
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
PDMM100157-01 20 µg
Recombinant Mouse IL-7 Rα/CD127 Protein (Fc Tag)
Sign In for Pricing
View Details