Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human/Cynomolgus monkey Activin receptor type-2A (ACVR2A), partial (Active)

This Recombinant Human Activin receptor type-2A (ACVR2A), partial spans the amino acid sequence from region 20-135aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Activin receptor type-2A; EC:2.7.11.30; Activin receptor type IIA (ACTR-IIA; ACTRIIA) ; ACVR2A; ACVR2

UniProt

P27037

Expression Region

20-135aa

Tag

C-terminal 10xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human ACVR2A at 2 μg/mL can bind Anti-ACVR2A&ACVR2B recombinant antibody. The EC50 is 5.139-5.959 ng/mL.

Form

Lyophilized powder

Molecular Weight

15.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AILGRSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCVEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPKPP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Bcl10 (Recombinant Rabbit, Monoclonal, IgG)
A109389 100 µL

Anti-Bcl10 (Recombinant Rabbit, Monoclonal, IgG)

Sign In for Pricing
View Details
Lentiviral mouse Tubb2b shRNA (UAS) - Lentiviral mouse Tubb2b shRNA (UAS, RFP) (25)
GTR15142343 1 Vial

Lentiviral mouse Tubb2b shRNA (UAS) - Lentiviral mouse Tubb2b shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
PUS3, NT (PUS3, tRNA pseudouridine(38/39) synthase, tRNA pseudouridine synthase 3, tRNA pseudouridylate synthase 3, tRNA-uridine isomerase 3) (MaxLight 650)
MBS6339214-01 0.1 mL

PUS3, NT (PUS3, tRNA pseudouridine(38/39) synthase, tRNA pseudouridine synthase 3, tRNA pseudouridylate synthase 3, tRNA-uridine isomerase 3) (MaxLight 650)

Sign In for Pricing
View Details
PUS3, NT (PUS3, tRNA pseudouridine(38/39) synthase, tRNA pseudouridine synthase 3, tRNA pseudouridylate synthase 3, tRNA-uridine isomerase 3) (MaxLight 650)
MBS6339214-02 5x 0.1 mL

PUS3, NT (PUS3, tRNA pseudouridine(38/39) synthase, tRNA pseudouridine synthase 3, tRNA pseudouridylate synthase 3, tRNA-uridine isomerase 3) (MaxLight 650)

Sign In for Pricing
View Details
PCDHGC3 Antibody
A30745-100UL 100 µL

PCDHGC3 Antibody

Sign In for Pricing
View Details
ANKRD34C Double Nickase Plasmid (h2)
sc-415896-NIC-2 20 µg

ANKRD34C Double Nickase Plasmid (h2)

Sign In for Pricing
View Details