Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Necator americanus Ancylostoma secreted protein 2 (ASP2)

This Recombinant Necator americanus Ancylostoma secreted protein 2 (ASP2) spans the amino acid sequence from region 20-210aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Secreted protein ASP-2

UniProt

Q7Z1H1

Expression Region

20-210aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Necator americanus (Human hookworm)

Field of Research

Cell Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GCPDNGMSEEARQKFLELHNSLRSSVALGQAKDGAGGNAPKAAKMKTMAYDCEVEKTAMNNAKQCVFKHSQPNQRKGLGENIFMSSDSGMDKAKAAEQASKAWFGELAEKGVGQNLKLTGGLFSRGVGHYTQMVWQETVKLGCYVEACSNMCYVVCQYGPAGNMMGKDIYEKGEPCSKCENCDKEKGLCSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

p107 Rabbit Polyclonal Antibody
HA500481 100 µL

p107 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal DEDD2 Antibody
NBP3-04558-20ul 20 µL

Rabbit Polyclonal DEDD2 Antibody

Sign In for Pricing
View Details
MAP2K2 (MEK2) mouse monoclonal antibody
E43B4141 100 µL

MAP2K2 (MEK2) mouse monoclonal antibody

Sign In for Pricing
View Details
TCP1 theta (CCT8) (NM_006585) Human Over-expression Lysate
LS010694-20ug 20 µg

TCP1 theta (CCT8) (NM_006585) Human Over-expression Lysate

Sign In for Pricing
View Details
N, N-Diethylaniline hydrochloride
BID2104-01 5 g

N, N-Diethylaniline hydrochloride

Sign In for Pricing
View Details
N, N-Diethylaniline hydrochloride
BID2104-02 10 g

N, N-Diethylaniline hydrochloride

Sign In for Pricing
View Details