Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Ribonuclease E (rne), partial

This Recombinant Escherichia coli Ribonuclease E (rne), partial spans the amino acid sequence from region 35-125aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RNase E

UniProt

P21513

Expression Region

35-125aa

Tag

C-terminal 6xHis-Myc-tagged

Source

Yeast

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EQKKANIYKGKITRIEPSLEAAFVDYGAERHGFLPLKEIAREYFPANYSAHGRPNIKDVLREGQEVIVQIDKEERGNKGAALTTFISLAGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human LAIR1 Protein (Gln 22-His 163) [Fc]
VAng-1874Lsx-1mg 1 mg

Human LAIR1 Protein (Gln 22-His 163) [Fc]

Sign In for Pricing
View Details
Pyrvinium Pamaote
B1593-25 25 mg

Pyrvinium Pamaote

Sign In for Pricing
View Details
Olr482 Protein Vector (Rat) (pPM-C-His)
PV290201 500 ng

Olr482 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
TRNAG37 Protein Vector (Human) (pPM-C-HA)
48063021 500 ng

TRNAG37 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Fzr1 Rabbit Polyclonal Antibody
TA339172 100 µL

Fzr1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Klhl8 sgRNA CRISPR Lentivector (Rat) (Target 3)
K6500504 1.0 µg DNA

Klhl8 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details