Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Aldehyde dehydrogenase, mitochondrial (Aldh2)

This Recombinant Rat Aldehyde dehydrogenase, mitochondrial (Aldh2) spans the amino acid sequence from region 20-519aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ALDH class 2; ALDH-E2; ALDH1

UniProt

P11884

Expression Region

20-519aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Rattus norvegicus (Rat)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

55.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SAAATSAVPAPNQQPEVFCNQIFINNEWHDAVSKKTFPTVNPSTGEVICQVAEGNKEDVDKAVKAAQAAFQLGSPWRRMDASDRGRLLYRLADLIERDRTYLAALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPGFGPTAGAAIASHEDVDKVAFTGSTEVGHLIQVAAGSSNLKRVTLELGGKSPNIIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDVYDEFVERSVARAKSRVVGNPFDSRTEQGPQVDETQFKKILGYIKSGQQEGAKLLCGGGAAADRGYFIQPTVFGDVKDGMTIAKEEIFGPVMQILKFKTIEEVVGRANNSKYGLAAAVFTKDLDKANYLSQALQAGTVWINCYDVFGAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKNS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr1451 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K7313306 1.0 µg DNA

Olr1451 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
1- (5-Methylpyrazin-2-yl) ethan-1-one
OR1004873-01 1 g

1- (5-Methylpyrazin-2-yl) ethan-1-one

Sign In for Pricing
View Details
1- (5-Methylpyrazin-2-yl) ethan-1-one
OR1004873-02 5 g

1- (5-Methylpyrazin-2-yl) ethan-1-one

Sign In for Pricing
View Details
ADAMTS-20 CRISPR/Cas9 KO Plasmid (m)
sc-432408 20 µg

ADAMTS-20 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
Box of 50 Sterile Ca Syringe Filter 0.22µm, 25 Mm
SF25CA22SL Box of 50

Box of 50 Sterile Ca Syringe Filter 0.22µm, 25 Mm

Sign In for Pricing
View Details
Prostaglandin I Synthase (PTGIS) Magnetic Luminex Assay Kit
LKU600986 96 Tests

Prostaglandin I Synthase (PTGIS) Magnetic Luminex Assay Kit

Sign In for Pricing
View Details