Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Puccinia triticina Secreted protein

This Recombinant Puccinia triticina Secreted protein spans the amino acid sequence from region 19-177aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

A0A180GYK0

Expression Region

19-177aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Puccinia triticina (isolate 1-1 / race 1 (BBBD) ) (Brown leaf rust fungus)

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DSAQSNASMSASQPKVSPMQCGNIFLPLSPVDIAEMQSKGGLSASERAKLSKDPVEAVCKSTATGTDGGICDFKSCSGKPAVCGTCYPVTMKEGKLVKTSETSVASVECGKNYFLKTEKDHNICTAYDNKMYSCTGECKASIECQSCVRMDDPAFKQAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD35 (CR1, Follicular Dendritic Cell Marker) (BSA & Azide Free) (APC)
MBS6265976-01 0.1 mL

CD35 (CR1, Follicular Dendritic Cell Marker) (BSA & Azide Free) (APC)

Sign In for Pricing
View Details
CD35 (CR1, Follicular Dendritic Cell Marker) (BSA & Azide Free) (APC)
MBS6265976-02 5x 0.1 mL

CD35 (CR1, Follicular Dendritic Cell Marker) (BSA & Azide Free) (APC)

Sign In for Pricing
View Details
POP4 AAV Vector (Rat) (CMV)
37231106 1 µg

POP4 AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details
MRPL43 (39S Ribosomal Protein L43, Mitochondrial, L43mt, MRP-L43, Mitochondrial Ribosomal Protein bMRP36a, MGC17989, MGC48892)
129870 50 µg

MRPL43 (39S Ribosomal Protein L43, Mitochondrial, L43mt, MRP-L43, Mitochondrial Ribosomal Protein bMRP36a, MGC17989, MGC48892)

Sign In for Pricing
View Details
Rabbit Anti-Rb2 p130 antibody
SL4984R-01 50 µL

Rabbit Anti-Rb2 p130 antibody

Sign In for Pricing
View Details
Rabbit Anti-Rb2 p130 antibody
SL4984R-02 100 µL

Rabbit Anti-Rb2 p130 antibody

Sign In for Pricing
View Details