Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Epstein-Barr virus Protein BMRF2 (BMRF2), partial

This Recombinant Epstein-Barr virus Protein BMRF2 (BMRF2), partial spans the amino acid sequence from region 180-217aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

P03192

Expression Region

180-217aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4)

Field of Research

Infectious Disease & Virology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

6.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RRNQIYTSGLERRRSIFCARGDHSVASLKETLHKCPWD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lamin B1 shRNA (h) Lentiviral Particles
sc-29386-V 200 µL

Lamin B1 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
KRT13 Antibody - C-terminal region : HRP (ARP42031_T100-HRP)
ARP42031_T100-HRP 100 µL

KRT13 Antibody - C-terminal region : HRP (ARP42031_T100-HRP)

Sign In for Pricing
View Details
TRIM72 Antibody (C-term)
MBS9201996-01 0.08 mL

TRIM72 Antibody (C-term)

Sign In for Pricing
View Details
TRIM72 Antibody (C-term)
MBS9201996-02 0.4 mL

TRIM72 Antibody (C-term)

Sign In for Pricing
View Details
TRIM72 Antibody (C-term)
MBS9201996-03 5x 0.4 mL

TRIM72 Antibody (C-term)

Sign In for Pricing
View Details
ZNF446 Antibody - N-terminal region : HRP (ARP35944_T100-HRP)
ARP35944_T100-HRP 100 µL

ZNF446 Antibody - N-terminal region : HRP (ARP35944_T100-HRP)

Sign In for Pricing
View Details