Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Collagen alpha-1 (XVIII) chain (COL18A1), partial

This Recombinant Human Collagen alpha-1 (XVIII) chain (COL18A1), partial spans the amino acid sequence from region 24-200aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P39060

Expression Region

24-200aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Musculoskeletal & Connective Tissue Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NLLNLNWLWFNNEDTSHAATTIPEPQGPLPVQPTADTTTHVTPRNGSTEPATAPGSPEPPSELLEDGQDTPTSAESPDAPEENIAGVGAEILNVAKGIRSFVQLWNDTVPTESLARAETLVLETPVGPLALAGPSSTPQENGTTLWPSRGIPSSPGAHTTEAGTLPAPTPSPPSLGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LCE6A Human siRNA Oligo Duplex (Locus ID 448835)
SR318625 1 Kit

LCE6A Human siRNA Oligo Duplex (Locus ID 448835)

Sign In for Pricing
View Details
Caldesmon (CALD) BioAssayTM ELISA Kit (Rat)
023864 96 Tests

Caldesmon (CALD) BioAssayTM ELISA Kit (Rat)

Sign In for Pricing
View Details
CD58 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-2498R-BF594 100 µL

CD58 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
Mouse FK506 binding protein 12-rapamycin associated protein 1 (FRAP) ELISA Kit
YP-W22035-01 48 Tests

Mouse FK506 binding protein 12-rapamycin associated protein 1 (FRAP) ELISA Kit

Sign In for Pricing
View Details
Mouse FK506 binding protein 12-rapamycin associated protein 1 (FRAP) ELISA Kit
YP-W22035-02 96 Tests

Mouse FK506 binding protein 12-rapamycin associated protein 1 (FRAP) ELISA Kit

Sign In for Pricing
View Details
Phospho-PDCD4 (Ser457) Polyclonal Antibody, PE-Cy7 Conjugated
bs-12591R-PE-Cy7 100 µL

Phospho-PDCD4 (Ser457) Polyclonal Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details