Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Trichoderma harzianum Endo-1,4-beta-xylanase

This Recombinant Trichoderma harzianum Endo-1,4-beta-xylanase spans the amino acid sequence from region 1-190aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Xylanase;1,4-beta-D-xylan xylanohydrolase

UniProt

P48793

Expression Region

1-190aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Trichoderma harzianum (Hypocrea lixii)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QTIGPGTGYSNGYYYSYWNDGHAGVTYTNGGGGSFTVNWSNSGNFVAGKGWQPGTKNKVINFSGSYNPNGNSYLSIYGWSRNPLIEYYIVENFGTYNPSTGATKLGEVTSDGSVYDIYRTQRVNQPSIIGTATFYQYWSVRRNHRSSGSVNTANHFNAWASHGLTLGTMDYQIVAVEGYFSSGSASITVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Slc39a6 (NM_001024745) Rat Tagged Lenti ORF Clone
RR206091L3 10 µg

Slc39a6 (NM_001024745) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
TNFRSF14 ORF Vector (Human) (pORF)
47206011 1.0 µg DNA

TNFRSF14 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
ELISA Kit for Solute Carrier Family 25 Member 20 (SLC25A20)
TRV-0037113-01 24 Tests

ELISA Kit for Solute Carrier Family 25 Member 20 (SLC25A20)

Sign In for Pricing
View Details
ELISA Kit for Solute Carrier Family 25 Member 20 (SLC25A20)
TRV-0037113-02 48 Tests

ELISA Kit for Solute Carrier Family 25 Member 20 (SLC25A20)

Sign In for Pricing
View Details
ELISA Kit for Solute Carrier Family 25 Member 20 (SLC25A20)
TRV-0037113-03 96 Tests

ELISA Kit for Solute Carrier Family 25 Member 20 (SLC25A20)

Sign In for Pricing
View Details
ELISA Kit for Solute Carrier Family 25 Member 20 (SLC25A20)
TRV-0037113-04 5x 96 Tests

ELISA Kit for Solute Carrier Family 25 Member 20 (SLC25A20)

Sign In for Pricing
View Details