Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Bromodomain-containing protein 4 (BRD4), partial

This Recombinant Human Bromodomain-containing protein 4 (BRD4), partial spans the amino acid sequence from region 342-460aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein HUNK1

UniProt

O60885

Expression Region

342-460aa

Tag

N-terminal 10xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PAPEKSSKVSEQLKCCSGILKEMFAKKHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPDE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNF111 Polyclonal Antibody
E-AB-18773-01 20 µL

RNF111 Polyclonal Antibody

Sign In for Pricing
View Details
RNF111 Polyclonal Antibody
E-AB-18773-02 60 µL

RNF111 Polyclonal Antibody

Sign In for Pricing
View Details
RNF111 Polyclonal Antibody
E-AB-18773-03 120 µL

RNF111 Polyclonal Antibody

Sign In for Pricing
View Details
RNF111 Polyclonal Antibody
E-AB-18773-04 200 µL

RNF111 Polyclonal Antibody

Sign In for Pricing
View Details
MOBKL2B (MOB3B) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A3]
TA501579AM 100 µL

MOBKL2B (MOB3B) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A3]

Sign In for Pricing
View Details
Ccdc97 Mouse Gene Knockout Kit (CRISPR)
KN502770 1 Kit

Ccdc97 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details