Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Bromodomain-containing protein 4 (BRD4), partial

This Recombinant Human Bromodomain-containing protein 4 (BRD4), partial spans the amino acid sequence from region 342-460aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein HUNK1

UniProt

O60885

Expression Region

342-460aa

Tag

N-terminal 10xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PAPEKSSKVSEQLKCCSGILKEMFAKKHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPDE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Car4 sgRNA CRISPR Lentivector (Rat) (Target 2)
K6930703 1.0 µg DNA

Car4 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
CD16 (CD16A, CD16a Antigen, Fc gamma R3, Fc gamma RIII alpha, Fc gamma RIII, Fc gamma RIIIa, FCRIIIA, FCGRIII, FCG3, FCGR3A, FCGR3A Protein, FcR10, FcR-10, FcRIII, FcRIIIa, IGFR3, IgG Fc Receptor III-2, Low Affinity Immunoglobulin gamma Fc Region Receptor III-A) (MaxLight 405) discontinued
124539-ML405 100 µL

CD16 (CD16A, CD16a Antigen, Fc gamma R3, Fc gamma RIII alpha, Fc gamma RIII, Fc gamma RIIIa, FCRIIIA, FCGRIII, FCG3, FCGR3A, FCGR3A Protein, FcR10, FcR-10, FcRIII, FcRIIIa, IGFR3, IgG Fc Receptor III-2, Low Affinity Immunoglobulin gamma Fc Region Receptor III-A) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Mouse Monoclonal KIF2C Antibody (KIF2C/4707)
NBP3-20554-100ug 100 µg

Mouse Monoclonal KIF2C Antibody (KIF2C/4707)

Sign In for Pricing
View Details
AGL63 Antibody
orb784524 2 mg

AGL63 Antibody

Sign In for Pricing
View Details
RPL22P1 sgRNA CRISPR Lentivector set (Human)
K1936201 3x 1.0 µg

RPL22P1 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
ADSL Antibody Blocking peptide
orb1444831 500 µg

ADSL Antibody Blocking peptide

Sign In for Pricing
View Details