Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Collagen alpha-1 (XVIII) chain (COL18A1), partial

This Recombinant Human Collagen alpha-1 (XVIII) chain (COL18A1), partial spans the amino acid sequence from region 24-200aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P39060

Expression Region

24-200aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Musculoskeletal & Connective Tissue Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NLLNLNWLWFNNEDTSHAATTIPEPQGPLPVQPTADTTTHVTPRNGSTEPATAPGSPEPPSELLEDGQDTPTSAESPDAPEENIAGVGAEILNVAKGIRSFVQLWNDTVPTESLARAETLVLETPVGPLALAGPSSTPQENGTTLWPSRGIPSSPGAHTTEAGTLPAPTPSPPSLGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-MART-1/ Melan-A/ MLANA Antibody Clone A103 + M2-7C10 + M2-9E3, Unconjugated-100ug
2315-MSM4-P1 100ug

Anti-MART-1/ Melan-A/ MLANA Antibody Clone A103 + M2-7C10 + M2-9E3, Unconjugated-100ug

Sign In for Pricing
View Details
PI3 Kinase p85 beta Rabbit mAb
E45R11781N-50 50 µL

PI3 Kinase p85 beta Rabbit mAb

Sign In for Pricing
View Details
Selenoprotein V Double Nickase Plasmid (h2)
sc-407114-NIC-2 20 µg

Selenoprotein V Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
Sphingosine 1 Phosphate  Receptor 1 (EDG-1)
X1217C 100 µL

Sphingosine 1 Phosphate Receptor 1 (EDG-1)

Sign In for Pricing
View Details
Rabbit Polyclonal ZBTB38 Antibody
NBP2-88605 100 µL

Rabbit Polyclonal ZBTB38 Antibody

Sign In for Pricing
View Details
Mouse Acetyl Coenzyme A Acetyltransferase 1 (ACAT1) ELISA Kit
BSKM64572-01 48 Tests

Mouse Acetyl Coenzyme A Acetyltransferase 1 (ACAT1) ELISA Kit

Sign In for Pricing
View Details