Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Bromodomain-containing protein 2 (BRD2), partial

This Recombinant Human Bromodomain-containing protein 2 (BRD2), partial spans the amino acid sequence from region 65-187aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Really interesting new gene 3 protein

UniProt

P25440

Expression Region

65-187aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EVSNPKKPGRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKIFLQKVASMPQEEQEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIM41 Polyclonal Antibody, PE-Cy7 Conjugated
bs-9151R-PE-Cy7 100 µL

TRIM41 Polyclonal Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
MMP28 (Matrix Metalloproteinase-28, MMP-28, Epilysin, MMP25, UNQ1893/PRO4339) (MaxLight 750) discontinued
129759-ML750 100 µL

MMP28 (Matrix Metalloproteinase-28, MMP-28, Epilysin, MMP25, UNQ1893/PRO4339) (MaxLight 750) discontinued

Sign In for Pricing
View Details
DLL4 Polyclonal Antibody PE Conjugated
MBS9463843-01 0.1 mL

DLL4 Polyclonal Antibody PE Conjugated

Sign In for Pricing
View Details
DLL4 Polyclonal Antibody PE Conjugated
MBS9463843-02 5x 0.1 mL

DLL4 Polyclonal Antibody PE Conjugated

Sign In for Pricing
View Details
Barbinervic acid
orb1683090 5 mg

Barbinervic acid

Sign In for Pricing
View Details
BAIAP2 (NM_006340) Human Tagged ORF Clone Lentiviral Particle
RC214570L4V 200 µL

BAIAP2 (NM_006340) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details