Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Bromodomain-containing protein 2 (BRD2), partial

This Recombinant Human Bromodomain-containing protein 2 (BRD2), partial spans the amino acid sequence from region 65-187aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Really interesting new gene 3 protein

UniProt

P25440

Expression Region

65-187aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EVSNPKKPGRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKIFLQKVASMPQEEQEL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Grade 41FF Quadrant Folded 110mm
10380204 10 / PCK

Grade 41FF Quadrant Folded 110mm

Sign In for Pricing
View Details
TOMM20 Rabbit Polyclonal Antibody (PE)
orb2450705 100 µL

TOMM20 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
Mouse Monoclonal BOB1 Antibody (BOB1/2424) [DyLight 650]
NBP2-75753C 0.1 mL

Mouse Monoclonal BOB1 Antibody (BOB1/2424) [DyLight 650]

Sign In for Pricing
View Details
Canine O-FQ ELISA Kit
ECO0018 96 Tests

Canine O-FQ ELISA Kit

Sign In for Pricing
View Details
Fam163a sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6477706 1.0 µg DNA

Fam163a sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Anti-AHA1/AHSA1 Antibody Picoband® (Carrier-free Conjugate)
A05733-carrier-free 100 µg/Vial

Anti-AHA1/AHSA1 Antibody Picoband® (Carrier-free Conjugate)

Sign In for Pricing
View Details