Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Tick-borne encephalitis virus European subtype Genome polyprotein, partial

This Recombinant Tick-borne encephalitis virus European subtype Genome polyprotein, partial spans the amino acid sequence from region 281-727aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Core protein; Matrix protein; NS1; NS2A; Flavivirin protease NS2B regulatory subunit; Non-structural protein 2B; Flavivirin protease NS3 catalytic subunit; Non-structural protein 3; NS4A; NS4B; Non-structural protein 5

UniProt

P14336

Expression Region

281-727aa

Tag

C-terminal 6xHis-tagged

Source

Baculovirus

Origin

Tick-borne encephalitis virus European subtype (strain Neudoerfl) (NEUV) (Neudoerfl virus)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

49.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SRCTHLENRDFVTGTQGTTRVTLVLELGGCVTITAEGKPSMDVWLDAIYQENPAKTREYCLHAKLSDTKVAARCPTMGPATLAEEHQGGTVCKRDQSDRGWGNHCGLFGKGSIVACVKAACEAKKKATGHVYDANKIVYTVKVEPHTGDYVAANETHSGRKTASFTISSEKTILTMGEYGDVSLLCRVASGVDLAQTVILELDKTVEHLPTAWQVHRDWFNDLALPWKHEGAQNWNNAERLVEFGAPHAVKMDVYNLGDQTGVLLKALAGVPVAHIEGTKYHLKSGHVTCEVGLEKLKMKGLTYTMCDKTKFTWKRAPTDSGHDTVVMEVTFSGTKPCRIPVRAVAHGSPDVNVAMLITPNPTIENNGGGFIEMQLPPGDNIIYVGELSHQWFQKGSSIGRVFQKTKKGIERLTVIGEHAWDFGSAGGFLSSIGKAVHTVLGGAFNS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Keratin 17
MBS6507858-01 0.5 mL

Keratin 17

Sign In for Pricing
View Details
Keratin 17
MBS6507858-02 5x 0.5 mL

Keratin 17

Sign In for Pricing
View Details
ATG9A Antibody
MBS150586-01 0.1 mg

ATG9A Antibody

Sign In for Pricing
View Details
ATG9A Antibody
MBS150586-02 5x 0.1 mg

ATG9A Antibody

Sign In for Pricing
View Details
ATP2B3 Adenovirus (Rat)
12690056 1.0 mL

ATP2B3 Adenovirus (Rat)

Sign In for Pricing
View Details
P38 MAPK (Phospho-Tyr322) discontinued
327183 100 µL

P38 MAPK (Phospho-Tyr322) discontinued

Sign In for Pricing
View Details