Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Origin recognition complex subunit 1 (ORC1), partial

This Recombinant Human Origin recognition complex subunit 1 (ORC1), partial spans the amino acid sequence from region 1-200aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Replication control protein 1

UniProt

Q13415

Expression Region

1-200aa

Tag

C-terminal 10xHis-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAHYPTRLKTRKTYSWVGRPLLDRKLHYQTYREMCVKTEGCSTEIHIQIGQFVLIEGDDDENPYVAKLLELFEDDSDPPPKKRARVQWFVRFCEVPACKRHLLGRKPGAQEIFWYDYPACDSNINAETIIGLVRVIPLAPKDVVPTNLKNEKTLFVKLSWNEKKFRPLSSELFAELNKPQESAAKCQKPVRAKSKSAESP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-c-ABL (Tyr245) Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-10355R-BF680 100 µL

Phospho-c-ABL (Tyr245) Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
GTPBP1, CT (GTPBP1, GTP-binding protein 1) (Biotin) discontinued
036369-Biotin 200 µL

GTPBP1, CT (GTPBP1, GTP-binding protein 1) (Biotin) discontinued

Sign In for Pricing
View Details
Myo15 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
31275124 3x 1.0µg DNA

Myo15 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
Edoxaban Impurity 56
RM-E042856-01 10 mg

Edoxaban Impurity 56

Sign In for Pricing
View Details
Edoxaban Impurity 56
RM-E042856-02 25 mg

Edoxaban Impurity 56

Sign In for Pricing
View Details
Edoxaban Impurity 56
RM-E042856-03 50 mg

Edoxaban Impurity 56

Sign In for Pricing
View Details