Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Apis mellifera Allergen Api m 6.03 / Api m 6.04

This Recombinant Apis mellifera Allergen Api m 6.03 / Api m 6.04 spans the amino acid sequence from region 22-92aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Allergen Api m 6

UniProt

P83563

Expression Region

22-92aa

Tag

C-terminal 10xHis-tagged

Source

Baculovirus

Origin

Apis mellifera (Honeybee)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FGGFGGFGGLGGRGKCPSNEIFSRCDGRCQRFCPNVVPKPLCIKICAPGCVCRLGYLRNKKKVCVPRSKCG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NOSIP Rabbit Polyclonal Antibody (BF555)
orb2497992 100 µL

NOSIP Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details
WTAP Mouse Monoclonal Antibody [Clone ID: LBI6H3]
AMM18279VCF 100 µg

WTAP Mouse Monoclonal Antibody [Clone ID: LBI6H3]

Sign In for Pricing
View Details
ZNF140 (NM_003440) Human Tagged ORF Clone
RG207210 10 µg

ZNF140 (NM_003440) Human Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Human MAN1A2 Protein
E30P00913A 50 µg

Recombinant Human MAN1A2 Protein

Sign In for Pricing
View Details
PGK2 CRISPR Activation Plasmid (h)
sc-404835-ACT 20 µg

PGK2 CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
Human EPPIN siRNA
abx901757-01 15 nmol

Human EPPIN siRNA

Sign In for Pricing
View Details