Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Apis mellifera Allergen Api m 6.03 / Api m 6.04

This Recombinant Apis mellifera Allergen Api m 6.03 / Api m 6.04 spans the amino acid sequence from region 22-92aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Allergen Api m 6

UniProt

P83563

Expression Region

22-92aa

Tag

C-terminal 10xHis-tagged

Source

Baculovirus

Origin

Apis mellifera (Honeybee)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FGGFGGFGGLGGRGKCPSNEIFSRCDGRCQRFCPNVVPKPLCIKICAPGCVCRLGYLRNKKKVCVPRSKCG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Paraoxonase 1 (PON1) ELISA Kit
orb1664015-01 48 Tests

Mouse Paraoxonase 1 (PON1) ELISA Kit

Sign In for Pricing
View Details
Mouse Paraoxonase 1 (PON1) ELISA Kit
orb1664015-02 96 Tests

Mouse Paraoxonase 1 (PON1) ELISA Kit

Sign In for Pricing
View Details
CYB5R3 Rabbit Polyclonal Antibody (Biotin)
orb2096821 100 µL

CYB5R3 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
SMYD3 discontinued
394684 200 µL

SMYD3 discontinued

Sign In for Pricing
View Details
Goat Anti-Chicken IgG (H&L) - AcalephFluor647
CSA3853-01 100 µL

Goat Anti-Chicken IgG (H&L) - AcalephFluor647

Sign In for Pricing
View Details
Goat Anti-Chicken IgG (H&L) - AcalephFluor647
CSA3853-02 500 μL

Goat Anti-Chicken IgG (H&L) - AcalephFluor647

Sign In for Pricing
View Details