Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Enterobacteria phage H19B Shiga-like toxin 1 subunit B (stxB)

This Recombinant Enterobacteria phage H19B Shiga-like toxin 1 subunit B (stxB) spans the amino acid sequence from region 21-89aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Verocytotoxin 1 subunit B ; Verotoxin 1 subunit B

UniProt

P69179

Expression Region

21-89aa

Tag

C-terminal 10xHis-tagged

Source

Baculovirus

Origin

Enterobacteria phage H19B (Bacteriophage H19B)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLLLSAQITGMTVTIKTNACHNGGGFSEVIFR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-MRPS32 Antibody
YLD5184-01 50 µL

Rabbit anti-MRPS32 Antibody

Sign In for Pricing
View Details
Rabbit anti-MRPS32 Antibody
YLD5184-02 100 µL

Rabbit anti-MRPS32 Antibody

Sign In for Pricing
View Details
ECI1 Peptide - C-terminal region (AAP48557)
AAP48557-100UG 100 µg

ECI1 Peptide - C-terminal region (AAP48557)

Sign In for Pricing
View Details
Recombinant Human AGFG1 Protein, N-His
bs-104018P-01 20 µg

Recombinant Human AGFG1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human AGFG1 Protein, N-His
bs-104018P-02 50 µg

Recombinant Human AGFG1 Protein, N-His

Sign In for Pricing
View Details
Atp5h sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
12738116 3x 1.0 µg

Atp5h sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details