Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia phage 933W Shiga-like toxin 2 subunit B (stxB2)

This Recombinant Escherichia phage 933W Shiga-like toxin 2 subunit B (stxB2) spans the amino acid sequence from region 20-89aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Verocytotoxin 2 subunit B ; Verotoxin 2 subunit B

UniProt

P09386

Expression Region

20-89aa

Tag

C-terminal 10xHis-tagged

Source

Baculovirus

Origin

Escherichia phage 933W (Bacteriophage 933W)

Field of Research

Infectious Disease & Virology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ADCAKGKIEFSKYNEDDTFTVKVDGKEYWTSRWNLQPLLQSAQLTGMTVTIKSSTCESGSGFAEVQFNND

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse CD36
MBS141185-01 0.002 mg

Recombinant Mouse CD36

Sign In for Pricing
View Details
Recombinant Mouse CD36
MBS141185-02 0.01 mg

Recombinant Mouse CD36

Sign In for Pricing
View Details
Recombinant Mouse CD36
MBS141185-03 1 mg

Recombinant Mouse CD36

Sign In for Pricing
View Details
Recombinant Mouse CD36
MBS141185-04 5x 1 mg

Recombinant Mouse CD36

Sign In for Pricing
View Details
ZHX2, NT (ZHX2, AFR1, KIAA0854, RAF, Zinc fingers and homeoboxes protein 2, Alpha-fetoprotein regulator 1, Regulator of AFP, Zinc finger and homeodomain protein 2) (MaxLight 650)
MBS6365323-01 0.1 mL

ZHX2, NT (ZHX2, AFR1, KIAA0854, RAF, Zinc fingers and homeoboxes protein 2, Alpha-fetoprotein regulator 1, Regulator of AFP, Zinc finger and homeodomain protein 2) (MaxLight 650)

Sign In for Pricing
View Details
ZHX2, NT (ZHX2, AFR1, KIAA0854, RAF, Zinc fingers and homeoboxes protein 2, Alpha-fetoprotein regulator 1, Regulator of AFP, Zinc finger and homeodomain protein 2) (MaxLight 650)
MBS6365323-02 5x 0.1 mL

ZHX2, NT (ZHX2, AFR1, KIAA0854, RAF, Zinc fingers and homeoboxes protein 2, Alpha-fetoprotein regulator 1, Regulator of AFP, Zinc finger and homeodomain protein 2) (MaxLight 650)

Sign In for Pricing
View Details