Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Putative phospholipase B-like 2 (Plbd2)

This Recombinant Mouse Putative phospholipase B-like 2 (Plbd2) spans the amino acid sequence from region 47-594aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

66.3 kDa protein;76 kDa protein (p76) ; LAMA-like protein 2; Lamina ancestor homolog 2; Phospholipase B domain-containing protein 2

UniProt

Q3TCN2

Expression Region

47-594aa

Tag

C-terminal 6xHis-tagged

Source

Baculovirus

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

62.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LPTLGPGWQRQNPDPPVSRTRSLLLDAASGQLRLEDGFHPDAVAWANLTNAIRETGWAYLDLSTNGRYNDSLQAYAAGVVEASVSEELIYMHWMNTVVNYCGPFEYEVGYCEKLKNFLEANLEWMQREMELNPDSPYWHQVRLTLLQLKGLEDSYEGRLTFPTGRFTIKPLGFLLLQISGDLEDLEPALNKTNTKPSLGSGSCSALIKLLPGGHDLLVAHNTWNSYQNMLRIIKKYRLQFREGPQEEYPLVAGNNLVFSSYPGTIFSGDDFYILGSGLVTLETTIGNKNPALWKYVQPQGCVLEWIRNVVANRLALDGATWADVFKRFNSGTYNNQWMIVDYKAFLPNGPSPGSRVLTILEQIPGMVVVADKTAELYKTTYWASYNIPYFETVFNASGLQALVAQYGDWFSYTKNPRAKIFQRDQSLVEDMDAMVRLMRYNDFLHDPLSLCEACNPKPNAENAISARSDLNPANGSYPFQALHQRAHGGIDVKVTSFTLAKYMSMLAASGPTWDQCPPFQWSKSPFHSMLHMGQPDLWMFSPIRVPWD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SRGAP3 siRNA (Human)
CRH6646-01 15 nmol

SRGAP3 siRNA (Human)

Sign In for Pricing
View Details
SRGAP3 siRNA (Human)
CRH6646-02 30 nmol

SRGAP3 siRNA (Human)

Sign In for Pricing
View Details
COX2 Antibody / Cyclooxygenase 2 / PTGS2
orb1824303-01 20 µg

COX2 Antibody / Cyclooxygenase 2 / PTGS2

Sign In for Pricing
View Details
COX2 Antibody / Cyclooxygenase 2 / PTGS2
orb1824303-02 100 µg

COX2 Antibody / Cyclooxygenase 2 / PTGS2

Sign In for Pricing
View Details
HOMER3 Rabbit Polyclonal Antibody (Fluoro488)
orb3097783 100 µg

HOMER3 Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details
ELISA Kit for Nuclear Factor, Erythroid Derived 2 Like Protein 2 (NFE2L2)
TRV-0050053-01 24 Tests

ELISA Kit for Nuclear Factor, Erythroid Derived 2 Like Protein 2 (NFE2L2)

Sign In for Pricing
View Details