Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Putative phospholipase B-like 2 (Plbd2)

This Recombinant Mouse Putative phospholipase B-like 2 (Plbd2) spans the amino acid sequence from region 47-594aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

66.3 kDa protein;76 kDa protein (p76) ; LAMA-like protein 2; Lamina ancestor homolog 2; Phospholipase B domain-containing protein 2

UniProt

Q3TCN2

Expression Region

47-594aa

Tag

C-terminal 6xHis-tagged

Source

Baculovirus

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

62.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LPTLGPGWQRQNPDPPVSRTRSLLLDAASGQLRLEDGFHPDAVAWANLTNAIRETGWAYLDLSTNGRYNDSLQAYAAGVVEASVSEELIYMHWMNTVVNYCGPFEYEVGYCEKLKNFLEANLEWMQREMELNPDSPYWHQVRLTLLQLKGLEDSYEGRLTFPTGRFTIKPLGFLLLQISGDLEDLEPALNKTNTKPSLGSGSCSALIKLLPGGHDLLVAHNTWNSYQNMLRIIKKYRLQFREGPQEEYPLVAGNNLVFSSYPGTIFSGDDFYILGSGLVTLETTIGNKNPALWKYVQPQGCVLEWIRNVVANRLALDGATWADVFKRFNSGTYNNQWMIVDYKAFLPNGPSPGSRVLTILEQIPGMVVVADKTAELYKTTYWASYNIPYFETVFNASGLQALVAQYGDWFSYTKNPRAKIFQRDQSLVEDMDAMVRLMRYNDFLHDPLSLCEACNPKPNAENAISARSDLNPANGSYPFQALHQRAHGGIDVKVTSFTLAKYMSMLAASGPTWDQCPPFQWSKSPFHSMLHMGQPDLWMFSPIRVPWD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phldb3 sgRNA CRISPR Lentivector (Rat) (Target 2)
K6208003 1.0 µg DNA

Phldb3 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Eletriptan hydrobromide 500mg
A11418-500 500 mg

Eletriptan hydrobromide 500mg

Sign In for Pricing
View Details
DNAJC2 AAV Vector (Human) (CMV)
18401101 1 µg

DNAJC2 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Ribonuclease 6 Polyclonal Antibody, FITC Conjugated
bs-5972R-FITC 100 µL

Ribonuclease 6 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
ATG5/APG5L Rabbit Polyclonal Antibody (BF647)
orb1604184 100 µL

ATG5/APG5L Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details
Recombinant Rat GALK2 Protein, His (Fc)-Avi-tagged
GALK2-2118R 50 µg

Recombinant Rat GALK2 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details