Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Putative phospholipase B-like 2 (Plbd2)

This Recombinant Mouse Putative phospholipase B-like 2 (Plbd2) spans the amino acid sequence from region 47-594aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

66.3 kDa protein;76 kDa protein (p76) ; LAMA-like protein 2; Lamina ancestor homolog 2; Phospholipase B domain-containing protein 2

UniProt

Q3TCN2

Expression Region

47-594aa

Tag

C-terminal 6xHis-tagged

Source

Baculovirus

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

62.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LPTLGPGWQRQNPDPPVSRTRSLLLDAASGQLRLEDGFHPDAVAWANLTNAIRETGWAYLDLSTNGRYNDSLQAYAAGVVEASVSEELIYMHWMNTVVNYCGPFEYEVGYCEKLKNFLEANLEWMQREMELNPDSPYWHQVRLTLLQLKGLEDSYEGRLTFPTGRFTIKPLGFLLLQISGDLEDLEPALNKTNTKPSLGSGSCSALIKLLPGGHDLLVAHNTWNSYQNMLRIIKKYRLQFREGPQEEYPLVAGNNLVFSSYPGTIFSGDDFYILGSGLVTLETTIGNKNPALWKYVQPQGCVLEWIRNVVANRLALDGATWADVFKRFNSGTYNNQWMIVDYKAFLPNGPSPGSRVLTILEQIPGMVVVADKTAELYKTTYWASYNIPYFETVFNASGLQALVAQYGDWFSYTKNPRAKIFQRDQSLVEDMDAMVRLMRYNDFLHDPLSLCEACNPKPNAENAISARSDLNPANGSYPFQALHQRAHGGIDVKVTSFTLAKYMSMLAASGPTWDQCPPFQWSKSPFHSMLHMGQPDLWMFSPIRVPWD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal CD161/NK1.1 Antibody (PK136) [mFluor Violet 500 SE]
FAB76141MFV500 0.1 mL

Mouse Monoclonal CD161/NK1.1 Antibody (PK136) [mFluor Violet 500 SE]

Sign In for Pricing
View Details
Mouse Follistatin-related protein 3 ELISA Kit
EK1333 Inquire

Mouse Follistatin-related protein 3 ELISA Kit

Sign In for Pricing
View Details
Anti-E Cadherin 1 CDH1 Antibody Picoband® (monoclonal, 9G2) Fluoro550 Conjugated
M00063-2-Fluoro550 100 µg/Vial

Anti-E Cadherin 1 CDH1 Antibody Picoband® (monoclonal, 9G2) Fluoro550 Conjugated

Sign In for Pricing
View Details
RAB6A (Ras-related Protein Rab-6A, Rab-6, RAB6) (HRP)
MBS6154484-01 0.1 mL

RAB6A (Ras-related Protein Rab-6A, Rab-6, RAB6) (HRP)

Sign In for Pricing
View Details
RAB6A (Ras-related Protein Rab-6A, Rab-6, RAB6) (HRP)
MBS6154484-02 5x 0.1 mL

RAB6A (Ras-related Protein Rab-6A, Rab-6, RAB6) (HRP)

Sign In for Pricing
View Details
UGT1A10 Antibody
E042804 100 µg -100 µL

UGT1A10 Antibody

Sign In for Pricing
View Details